Loading...
Statistics
Advertisement

深圳前海策马投资管理有限公å ...
www.cemaren.com/

Cemaren.com

Advertisement
Conversion Technology Metas Server
Cemaren.com is hosted in China / Hangzhou . Cemaren.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Flexslider, Html, Number of used javascripts: 4. First javascripts: TweenMax.min.js, Jquery-1.10.2.min.js, Jquery.flexslider.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1h PHP/5.4.27.

Technologies in use by Cemaren.com

Technology

Number of occurences: 5
  • CSS
  • Flexslider
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 4
  • TweenMax.min.js
  • jquery-1.10.2.min.js
  • jquery.flexslider.js
  • index.js

Server Type

  • Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1h PHP/5.4.27

Powered by

  • PHP/5.4.27

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cemaren.com

Missing HTTPS protocol.

    Meta - Cemaren.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=utf-8
    • Name: description
      Content:
    • Name: keywords
      Content:

    Server / Hosting

    • IP: 120.24.61.186
    • Latitude: 30.29
    • Longitude: 120.16
    • Country: China
    • City: Hangzhou

    Rname

    • dns9.hichina.com
    • dns10.hichina.com
    • mxbiz2.qq.com
    • mxbiz1.qq.com

    Target

    • hostmaster.hichina.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 19 Apr 2016 16:13:36 GMT Server: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1h PHP/5.4.27 X-Powered-By: PHP/5.4.27 Content-Type: text/html; charset=utf-8

    DNS

    host: cemaren.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 120.24.61.186
    host: cemaren.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns9.hichina.com
    host: cemaren.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns10.hichina.com
    host: cemaren.com
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: dns9.hichina.com
    5. rname: hostmaster.hichina.com
    6. serial: 2015041919
    7. refresh: 3600
    8. retry: 1200
    9. expire: 3600
    10. minimum-ttl: 360
    host: cemaren.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 10
    5. target: mxbiz2.qq.com
    host: cemaren.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 5
    5. target: mxbiz1.qq.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.emaren.com, www.cdemaren.com, www.demaren.com, www.cremaren.com, www.remaren.com, www.ctemaren.com, www.temaren.com, www.cvemaren.com, www.vemaren.com, www.cfemaren.com, www.femaren.com, www.cgemaren.com, www.gemaren.com, www.chemaren.com, www.hemaren.com, www.cnemaren.com, www.nemaren.com, www.cmemaren.com, www.memaren.com, www.cjemaren.com, www.jemaren.com, www.cmaren.com, www.cexmaren.com, www.cxmaren.com, www.cesmaren.com, www.csmaren.com, www.cewmaren.com, www.cwmaren.com, www.cermaren.com, www.crmaren.com, www.cefmaren.com, www.cfmaren.com, www.cevmaren.com, www.cvmaren.com, www.cecmaren.com, www.ccmaren.com, www.ceqmaren.com, www.cqmaren.com, www.ceamaren.com, www.camaren.com, www.ceymaren.com, www.cymaren.com, www.cearen.com, www.cemparen.com, www.ceparen.com, www.cemoaren.com, www.ceoaren.com, www.cemiaren.com, www.ceiaren.com, www.cemkaren.com, www.cekaren.com, www.cem.aren.com, www.ce.aren.com, www.cemuaren.com, www.ceuaren.com, www.cemjaren.com, www.cejaren.com, www.cemnaren.com, www.cenaren.com, www.cem-aren.com, www.ce-aren.com, www.cemren.com, www.cemaoren.com, www.cemoren.com, www.cemapren.com, www.cempren.com, www.cema9ren.com, www.cem9ren.com, www.cemaren.com, www.cemren.com, www.cemairen.com, www.cemiren.com, www.cemauren.com, www.cemuren.com, www.cemaen.com, www.cemarien.com, www.cemaien.com, www.cemaroen.com, www.cemaoen.com, www.cemarlen.com, www.cemalen.com, www.cemarlen.com, www.cemalen.com, www.cemar.en.com, www.cema.en.com, www.cemarn.com, www.cemarexn.com, www.cemarxn.com, www.cemaresn.com, www.cemarsn.com, www.cemarewn.com, www.cemarwn.com, www.cemarern.com, www.cemarrn.com, www.cemarefn.com, www.cemarfn.com, www.cemarevn.com, www.cemarvn.com, www.cemarecn.com, www.cemarcn.com, www.cemareqn.com, www.cemarqn.com, www.cemarean.com, www.cemaran.com, www.cemareyn.com, www.cemaryn.com, www.cemare.com, www.cemarenn.com, www.cemaren.com, www.cemarenh.com, www.cemareh.com, www.cemarenj.com, www.cemarej.com, www.cemarenk.com, www.cemarek.com, www.cemarenl.com, www.cemarel.com, www.cemaren .com, www.cemare .com,

    Other websites we recently analyzed

    1. 现货沥青即刻开启翻倍赚钱之旅
      Shanghai (China) - 222.73.144.205
      Server software: 360wzws
      Technology: CSS, Html, Javascript
      Number of Javascript: 5
      Number of meta tags: 1
    2. Singapore's Authentic Dragon's Beard Candies - Stage Elegance
      Stage Elegance proudly presents: the 'Authentic Singapore Dragon's Beard Candies', a traditional chinese delicacy, made by Aunty Ho Lili! Suitable for Dinner and Dance, cultural events, trade fairs and food bazaars!
      Singapore (Singapore) - 203.175.162.72
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, Php
      Number of Javascript: 3
      Number of meta tags: 2
    3. sfs.navy
      Scottsdale (United States) - 50.63.202.35
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. cvscaremarkspecialtypharmacy.net
      Provo (United States) - 50.87.144.197
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    5. App "bc5c3f2c7d" set up by ServerPilot
      Rochester (United States) - 216.126.197.41
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Php
      Number of meta tags: 1
    6. it-bgroup.ru
      Russian Federation - 91.209.16.65
      Server software: nginx/1.0.6
      Technology: Html
    7. The Family of Faith Lutheran Church | FOF
      Absecon (United States) - 74.207.229.115
      Server software: nginx
      Technology: CSS, Flexslider, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, WordPress Stats, Wordpress
      Number of Javascript: 17
      Number of meta tags: 2
    8. mauicondotax.com
      Wayne (United States) - 74.208.215.132
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. Ponderings and Musings – Is there anyone out there who thinks like me? If not, is there anyone out there who likes to think?
      Scottsdale (United States) - 166.62.110.213
      Server software:
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    10. TBH Timmerwerken
      TBH Timmerwerken heeft een moderne uitgebreide timmerwerkplaats in Moergestel, vlakbij Tilburg. TBH kan uw timmerwerk verzorgen in de meest ruime zin des woords zowel in de werkplaats als op de bouwplaats.
      Netherlands - 128.140.218.121
      Server software: Apache/2
      Technology: CSS, Flexslider, Font Awesome, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 4

    Check Other Websites